HORDB

ID: hor004572
Uniprot ID: P20065(1-50)
Protein name: Thymosin beta-4
Gene name: Tmsb4x
Organism: Mus musculus (Mouse)
Family: Thymosin beta family
Source: animal
Expression: Originally found in thymus but it is widely distributed in many tissues.
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003779 actin binding; GO:0003785 actin monomer binding; GO:0005515 protein binding; GO:0019899 enzyme binding; GO:0140311 protein sequestering activity
GO BP: GO:0007015 actin filament organization; GO:0014911 positive regulation of smooth muscle cell migration; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers; GO:0045893 positive regulation of DNA-templated transcription; GO:0051152 positive regulation of smooth muscle cell differentiation
GO CC: GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005856 cytoskeleton

Sequence: MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Length: 50(1-50)
Propeptide: MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Signal peptide: NA
Modification: T8 Phosphoserine;T10 N6-acetyllysine;T18 N6-acetyllysine;T29 Phosphothreonine;T32 N6-acetyllysine;T37 Phosphoserine;T38 N6-acetyllysine;T40 Phosphothreonine;T45 N6-acetyllysine
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the organization of the cytoskeleton.
Mechanism: Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-P20065-F1.pdb

hor004572_AF2.pdb

hor004572_ESM.pdb

Mass:	655364	Formula:	C244H407N63O85S3
Absent amino acids:	CHRVWY	Common amino acids:	KE
pI:	4.72	Basic residues:	9
Polar residues:	10	Hydrophobic residues:	10
Hydrophobicity:	-124.6	Boman Index:	-13181
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	52.8
Instability Index:	7095.6	Extinction Coefficient cystines:	0
Absorbance 280nm:	0